PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ZF-HD
Protein Properties Length: 271aa    MW: 29801.4 Da    PI: 7.5864
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58677226PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.23e-3165118559
  ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  rY+eClkN Aa++Gg  +DGCgEfmps g++gt +alkCaAC+CHRnFHR+e+++
    Lsa017109  65 RYRECLKNYAANIGGSITDGCGEFMPS-GDDGTLEALKCAACNCHRNFHRKETTT 118
                  8*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2162115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.2E-2965116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-2865115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.06466115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.36E-16196258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28198261IPR009057Homeodomain-like
TIGRFAMsTIGR015654.1E-28199255IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEMSGTDKEI RMQTSSFPYN NHQLIHESSS EIMDHGSDPD RFDGSGASAT PISVGSRLLK  60
SPPPRYRECL KNYAANIGGS ITDGCGEFMP SGDDGTLEAL KCAACNCHRN FHRKETTTAA  120
AITAGPFLQL PPPLPSHSPL FNSHQRTSTS TVSLHHNPNW VSSINAPPVR IAVGGSGAAT  180
ESSSEELYFT AVPPYGVAKK RFRSKFTQDQ KEKMLEFAEK VGWRIPREDD PEVQRFCAEV  240
GVKRQVLKVW MHNNKAISGK KQVPDSNENI D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242002551873ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.15e-78PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9M9S08e-62ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A103YCG21e-162A0A103YCG2_CYNCS; Homeodomain-like protein
STRINGPGSC0003DMT4000095814e-69(Solanum tuberosum)